McDonnell Genome Institute

Washington University

CircRNA

chr12|111418118|111418877|+|SH2B3|ENST00000341259.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

47

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

GAEGGGAALQPGR

Amino Acids from 5' Exons

PGRTTWVSAMNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRAELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARSSEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAKKFLPWSLAREPPPEALKEAVLRYSLADEASMDSGARWQRGRLALRRAPGPDGPDRVLELFDPPK,PAAPPGSPPTGLPCSPPRPLPRPQPPRRRPRGAGASSVSCTPRRPGSWPASTGCSPGSIRSTRRCAPSWCRCSSPTSSSATSAARCATDGRRAATTGTQAVGPQPRPRRPRSQAPAPPPLACPRPAALRSWPRRGRPGPAPSSTFAAASATSSAAARPGSCQRPTPLPPPGPPERLLRPPPGLAWPRSSCPGAWPGSRHPRRRRRCCATAWPTRPPWTAGHAGSAGGWRCAGPRAPMAPTACWSSSTHP,RPHHLGLRHERACPAALLALFRALSLPGGGPAGLERVLVARRSGGPGAGPPVLAVRPGASAARAAARRAGVAAVHRPLPALLLPRGARRTGAGPRLPGHRPWAPSQGRGVPGARPRPRRPWPAQGPQLGAGPAAAARALLLPALSPQPPPHLPPPLGRGAASGPHRCRPRDPRRGCDPRPAWPGQEVPALEPGPGAATRGAEGGGAALQPGRRGLHGQRGTLAAREAGAAPGPGPRWPRPRAGALRPTQ

Amino Acids from 3' Exons

PGRTTWVSAMNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRAELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARSSEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAKKFLPWSLAREPPPEALKEAVLRYSLADEASMDSGARWQRGRLALRRAPGPDGPDRVLELFDPPK,PAAPPGSPPTGLPCSPPRPLPRPQPPRRRPRGAGASSVSCTPRRPGSWPASTGCSPGSIRSTRRCAPSWCRCSSPTSSSATSAARCATDGRRAATTGTQAVGPQPRPRRPRSQAPAPPPLACPRPAALRSWPRRGRPGPAPSSTFAAASATSSAAARPGSCQRPTPLPPPGPPERLLRPPPGLAWPRSSCPGAWPGSRHPRRRRRCCATAWPTRPPWTAGHAGSAGGWRCAGPRAPMAPTACWSSSTHP,RPHHLGLRHERACPAALLALFRALSLPGGGPAGLERVLVARRSGGPGAGPPVLAVRPGASAARAAARRAGVAAVHRPLPALLLPRGARRTGAGPRLPGHRPWAPSQGRGVPGARPRPRRPWPAQGPQLGAGPAAAARALLLPALSPQPPPHLPPPLGRGAASGPHRCRPRDPRRGCDPRPAWPGQEVPALEPGPGAATRGAEGGGAALQPGRRGLHGQRGTLAAREAGAAPGPGPRWPRPRAGALRPTQ