McDonnell Genome Institute

Washington University

CircRNA

chr12|111338285|111342053|+|CUX2|ENST00000261726.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9147

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

AAAVWGK

Amino Acids from 5' Exons

GSGCLGKASWVHRAPCLTCCPGPNPGTSARGGSLLSACSCGSMTPITWRSGIRSWRRK,AAAVWGKHPGSDTGLRVPAVPAQTLAQAEPEGAGAFCPHAAVAQPPRGEAEGYEEAGEE,QRLFGESILGLTQGSVSDLLSRPKPWHKLSLKGREPFVRMQLWLNDPHNVEKLRDMKKLEKK

Amino Acids from 3' Exons

PTNVAMASSAPAQTVSPRPPAQSAPAPACSPRTASCRSRSPGWCWHPRRRRHCGRPISWNPTPRSRPSSSSPSSSTSRPTPSSTGSTTT,LPETSLWPHQHRLRQVPGHPLRVPQPLPAAPGPEPPADQEAPGGAGTRGEGGTAEGLSAGTLPLAADHRAPLLPAQPQDQHRHQLVPQLQ,YLKRRYGLISTGSDSESPATRSECPSPCLQPQDLSLLQIKKPRVVLAPEEKEALRKAYQLEPYPSQQTIELLSFQLNLKTNTVINWFHNY