McDonnell Genome Institute

Washington University

CircRNA

chr12|1110191|1116033|+|ERC1|ENST00000347735.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

AAILQTEDSK

Amino Acids from 5' Exons

DSKISSMERGLRDLEEEIQMLKSNGALSTEEREEEMKQMEVYRSHSKFMKNK,IQKFPLWSVGFETWKRKFRCNRMVLVLRKGKKKSKWKCIGAILNLKI,FKNFLYGAWASRPGRGNSDAEIEWCFEYGKGRRNEANGSVSEPFIYEK

Amino Acids from 3' Exons

IGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTE,LARNRSCPERTQNYSPCRQSKHSQTSSQIVNSTLKCRSPLLRSRGLPSCRL,WPGETGAVQKGHRTTRPADKARNTHKPVLRTAHSVEGVLDCGAEGCHPAD