McDonnell Genome Institute

Washington University

CircRNA

chr12|110339280|110340994|+|ATP2A2|ENST00000308664.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

14

Peptide

IVEFLQSFDEITAMVIK

Amino Acids from 5' Exons

VIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVK,SLNSKRNSLSFHVTESQCRFTVHQINQAGHQARCL,HTADEKGIHSRVFTQKVNVGLLYTKTKQDINEQDVCE

Amino Acids from 3' Exons

TNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAM,PIPSLAAWACWILRESRWPPPSCAGKQASGSSSLGTTRALLWPSVAASASSGRMRTRQKLSQAGSLMNSTPPPSETPATPAVLLELNPPTSLKSNFFSLLMRLQL,QSDLRWLRGHAGSSENRGGLLREAVPASRHPGHHDHWGQQGHCCGHLSPHRHLRAGGRDVKSFHRPGVTQPLRPARRLPERPLFCSSTLPQVNRRISSVFDYSY