McDonnell Genome Institute

Washington University

CircRNA

chr12|110322991|110328017|+|ATP2A2|ENST00000308664.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9891

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

13

Peptide

TGTLTTNQMSVCRLVTK

Amino Acids from 5' Exons

LVTKFLLIGLPSNLPHELTSQFSQ,WQSSCYKVNFHQIYHTKSPVNSH,GDKVPADIRLTSIKSTTLRVDQSILT

Amino Acids from 3' Exons

GTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCR,VQTLLLGKLWEWWQLELTPKLARSGMKWWQQNRREHPFSKNMNLGNSFPKSSPLFALQSGSILGTSMTRFMEGPGSEVLFTTLKLQWPWLQPFLKVCLQSSPPAWLLELAEWQRKMPLFEASRLWKPLVVLLLSAQTRLVHLQQTRCQSA,YKHCCWESYGSGGSNWSHRNWQDPGNGGNRTGENTPSAKTRIWGTAFQSHLPYLHCSLDHKYWALQPGSWRVLDQRCYLLLNCSGPGCSSHSRSACSHHHLPGSWNSQNGKEKCHCSKPPVCGNPWLYFCYLLRQDWYTYNKPDVSLQ