McDonnell Genome Institute

Washington University

CircRNA

chr12|110128949|110143545|+|IFT81|ENST00000242591.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

32

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

LIFLNLNLK

Amino Acids from 5' Exons

EYFSSGFGDWKTCNLPSAPLASSEDTEEKSIFSSFFNKTGTKVSSGNCGHQT,STFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQ,VLFVRVWLEVNLFTQCSTGFFRGLMNRKEHILVFNLRYQVSFFRMKLWLTPIN

Amino Acids from 3' Exons

VRGRRRNLIYIWLKNFLKNKIRKRNYIFYKKFQSQLWAILIFLNLNL,FNEEARGGDKIFIYGNKISRIRKEKGITFFTKSSFRASYGPFSSTI,LMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVSEPAMGHSDLLELESK