McDonnell Genome Institute

Washington University

CircRNA

chr12|110012004|110030758|+|ANKRD13A|ENST00000261739.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9655

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

4

Peptide

LIQNVEAVDPRGR

Amino Acids from 5' Exons

NVEAVDPRGRTLLHLAVSLGHLESARVLLRHKADVTKENRQGWT,MWRLWTHEVEHYCILLFPWDIWNLLESYSDIKQMQKKIARDGQ,CGGCGPTRSNIIASCCFLGTFGICSSLTPTSRCDKRKSPGMD

Amino Acids from 3' Exons

KFPCFMSMHGLHLEMLMAVALPKNLYLKMWKGPRLIQ,NSLVSCLKCTDYIWKCWLHCRRICISKCGRDPGF,IPLFHVLNARITFGNVNGCSTAEESVSQNVEGTQADS