top of page

McDonnell Genome Institute

Washington University

CircRNA

chr12|109934021|109947504|-|GIT2|ENST00000354574.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

12

Peptide

AALFPKLQTLQSENSNLR

Amino Acids from 5' Exons

LYSLLREDTRSCYRNGSIIPQ,YIPCSERIHVAVTEMAALFPK,IFPAQRGYTLLQKWQHYSP

Amino Acids from 3' Exons

LQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAH,FKHSRVKIRTSGNRPQPMYIRCKLVLSTQTLPTTLPRDVRLPGAVGPCPCTRPDQVRNHISQWEKRAAPKRAGDSSPSPR,SNTPEKFEPQETGHNQCISGANWFVHRHFQPLFLKETSVCPGQAHVHVRDRIRSETISPNGRSEPPRREQDETPALPRA

bottom of page