McDonnell Genome Institute

Washington University

CircRNA

chr12|109167895|109216920|+|ACACB|ENST00000338432.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9509

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

8

Peptide

NQLVIMLIVLIANNGIAAVK

Amino Acids from 5' Exons

VLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANA,CLLPTTGLPPSACAPSAGGPMRCSATSGPSGLLWPPRTLRPTQ,AYCQQRDCRREVHALHPQVGLDVPQRAGHPVCCDGDPRGPGQR

Amino Acids from 3' Exons

PTTTSVTSGSSSSQTCPRCWTASSPTHRWPRRTSWSC,PLRQVCDKPQGAVQARHVPGAGLHLLPRTGGQEEPAGDHVD,HYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLI