McDonnell Genome Institute

Washington University

CircRNA

chr12|109167895|109171914|+|ACACB|ENST00000338432.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.977

37

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

5

Peptide

RIPVQVLIANNGIAAVK

Amino Acids from 5' Exons

VLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANA,CLLPTTGLPPSACAPSAGGPMRCSATSGPSGLLWPPRTLRPTQ,AYCQQRDCRREVHALHPQVGLDVPQRAGHPVCCDGDPRGPGQR

Amino Acids from 3' Exons

STSRWRIITSPSQEGPITTTMPTWSLWTLPRESPC,VHQDGGSLRPRPRRAQQQLCQRGADCGHCQENPRA,YIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQ