McDonnell Genome Institute

Washington University

CircRNA

chr12|109166860|109179297|+|ACACB|ENST00000338432.11

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9258

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

23

Peptide

LTSMGMLCLCLVATAPSSGGIRR

Amino Acids from 5' Exons

AEHVGTPPGEEGTGTQEAGPAQRLYRGFSRVCHTLWGGSGHRE,PSMSGLHLVKRGREHKKLDLHRDFTVASPAEFVTRFGGDRVIEK,RACRDSTWRGDGNTRSWTCTETLPWLLPLSLSHALGGIGSSR

Amino Acids from 3' Exons

VQSEIPGSPIFLMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAPLAIFEFMEQ,YRVRSQARPSFSSWPSTPVTWKFRSSLTSMGMLCLCLVATAPSSGGIRRSLRKHRPPSPRWPYSSSWS,TEDPRLAHLSHEAGPARPSPGSSDPRPVWECCVSVWSRLLHPAAASEDRGSTGHHRPAGHIRVHGA