McDonnell Genome Institute

Washington University

CircRNA

chr12|1083163|1371977|+|ERC1|ENST00000347735.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.904

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

QQHMQMTIQALQDELR

Amino Acids from 5' Exons

HMQMTIQALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLLEQKEKENSMLRE,TCRQSRLSRMNCGSRGTISCFSRIVAAGLANLVQSQRRTFRGFMLSMSGRPKSCFFFERHWRKWSCVLRLKSRPMLGMNPLRSFWKCCRAKDFLPRLPRKTMREQDDWQRQRCTFITKAFWSRRKKRTVCE,HADDNPGSPGIADPEGPESAVSAGQQDWRTLCSRADRGELSEASCAAAGQRAVSSSKDIGGNGAAYDSKADPKCSGIHEASGNVAEQRTFCQGYRGRPENKTTGRGRDARSSPRKPFGAEGKREQYVER

Amino Acids from 3' Exons

ARSSSGCHKRRQYSSLGAFVLEEDPRGSGCPEAGEGSSGTAAAA,QEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKDRLVQQLKQQ,KKLFWLPLVKKTPILSWSFRPLRRRPKRKWLPSGRRIVWYSSLSS