McDonnell Genome Institute

Washington University

CircRNA

chr12|106999550|107001948|-|CRY1|ENST00000008527.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9438

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

GDLWISWEEGMKDHR

Amino Acids from 5' Exons

VKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMK,RRTVPLPFPFMGNCYGVNFSIQQQQIIHALIKWKETLSVFRFLGIKILRLPNGRKAGQAFHGLMPSHSFVRRVGFIIPGMQLLASHEGTCGLVGKKE,KEEQFPSPFPLWATVMAIFLYSSNKSTLNGRKPYLCSDSLGKSGFSQMGGRPDRLSMDCHHDTASSGGLDSSSSQACSCLLPDTRGPVDLGRRNE

Amino Acids from 3' Exons

DHRTQWWTTASNLKIPDSHQQNGTTRDTSRDNYFRSDRKVHNSSVPEIWSPFTGRA,IIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEEL,SNSMVDNRLLIKDSRLSSAKWNHRYQRQLLQKKSAQLLCLMTMMRNMESLHWKS