McDonnell Genome Institute

Washington University

CircRNA

chr12|105149614|105164307|+|KIAA1033|ENST00000332180.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.996

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

6

Peptide

LDVYLQVNFTYQFLKK

Amino Acids from 5' Exons

VNFTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHK,LISPTSFKRSSIYLANLCMMNTSNPDLKIFDFSGKLRTKMII,FHLPVFEKEVLYIPIYVTHQIQIDRYSIFQGNGPKS

Amino Acids from 3' Exons

VWLTFSFWISIGSLIHFTGSSLLERNTRREQLLSNRMYSQPVKMKNSYKPISLRSDWMSIY,CGLHSKAFGSVSGVFTSLVPVCREIPEGDKSSCATECTVSQSRKTLTNHESHSEATGCLST,VAYILKLLDQYREFDSLHWFQSVREKYLKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDVYLQ