McDonnell Genome Institute

Washington University

CircRNA

chr12|104321090|104339273|+|TXNRD1|ENST00000354940.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9712

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

8

Peptide

LESTLSVQSDDLFSLPYCPGK

Amino Acids from 5' Exons

SFLLALLPGDPGCWSILCRFGVRWISCWYWFRRHCYGVHSSRIPGHGQQNWTHGRTWHQVYKTVRTN,DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIK,MIFSPCLTARVRPWLLEHPMSLWSALDFLLVLVTSLLWLGPFFLEDLTRTWPTKLVNTWKNMASSLDSSYQL

Amino Acids from 3' Exons

ERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAE,NVLWAFTYWVQMLEKLHKALQLRSNVDPKSSWTAQLESTLSVQ,TCCGLSRTGSKCWRSYTRLCSCAQMWTDQKAAGQHNWNPPCLCR