McDonnell Genome Institute

Washington University

CircRNA

chr12|103941831|103942796|+|HSP90B1|ENST00000299767.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

37

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

EVDSDDLPLNVSR

Amino Acids from 5' Exons

VDSDDLPLNVSRETLQQHKLLK,WTQMISPMFPARLFSNINCL,GLRSPLECFPRDSSATTA

Amino Acids from 3' Exons

VIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKE,LGRSLFVKRWTSRRLLMINTMILFGKNLVPTSSLVLKTTRIEHVLLNFLGSSLLIIQLTLLATSMWKERKNKTKSTSWLGPAEK,DEEACSNAGHDQEDCIQYFLERIWYQHQAWCDRPLESNTSCTSVPVFSSSNHYPRPVCGKNEGKTRQNLLHGWVQQKR