McDonnell Genome Institute

Washington University

CircRNA

chr12|103937694|103943874|+|HSP90B1|ENST00000299767.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9403

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

4

Peptide

DISTNLVLKEEASDYLELDTIK

Amino Acids from 5' Exons

PCLKRRSILPIGYNKSRQKIFTVHKLSYLCMEQQ,LVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSK,LSKKKHLITLNWIQLKISSKNIHSSTFLFMYGAA

Amino Acids from 3' Exons

IEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDIST,LKRLWCLSAQNLRVLWWPASTDGLATWRESKHKRTKRARTSLQ,KGCGVSAPDRISVCFGGQPVRMVWQHGENHESTSVPNGQGHLYK