McDonnell Genome Institute

Washington University

CircRNA

chr12|103932276|103934287|+|HSP90B1|ENST00000299767.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.992

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

10

Peptide

GNTLGRGTTITEEEAIQLDGLNASQIR

Amino Acids from 5' Exons

RGRSYSVGWIKCITNKRTREVGKVCLPSRSQNDETYHQFIVKR,EEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKE,RKKLFSWMDMHHKENLERSRKSLPSKPKLTENLSSIHCIKIK

Amino Acids from 3' Exons

CDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTI,VIRRRTCCMSQTPVEPEKSWLKTLVPPNLGQASFTKLKHRKMASQLLNLASLVSVSIPPSLQIRLLSLQNTTTIPSTSGSLTPMNFLLLTQEETLDGERQL,GEEPAACHRHRCRNDQRRVGKPWYHSQIWDKRVFKQNDSTGRWPVNFIDWPVWCRFLFRLPCSRGYCHFKTQQRYPAHLGVLQIFCNCPKRKHSRTGNDNY