McDonnell Genome Institute

Washington University

CircRNA

chr12|101396398|101405981|-|ARL1|ENST00000261636.12

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.996

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

5

Peptide

GTGLDEAMEWWLFLK

Amino Acids from 5' Exons

EEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAME,KKSEKPFWCLQINRTWNRPLPQRWQIHLGYLPRTENGRYSKRQQPKAPALMRQWN,RRAEKSHFSGVCKTGHGTGHDFLRDGKFTWVTCLEGPKMADIQNVSNQRHRPGNGM

Amino Acids from 3' Exons

VAFSQVYFPVCLELGKEFFWDMEQEKPQFCTDYKWEKLLLLYL,WLFLKYIFQSVWNSGNENFNFGIRWSRKNHNFVQITSGRSCYYYT,GFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIP