McDonnell Genome Institute

Washington University

CircRNA

chr12|101361961|101379558|+|UTP20|ENST00000261637.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9298

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

9

Peptide

FLASDLDQKVHVLTFTVHMLLQGLTNK

Amino Acids from 5' Exons

VHVLTFTVHMLLQGLTNKLQVGDLDSCLDIMIE,SMCLSPFTCCCKASPISCRSEIWTLVIL,PCADFHRSHAAARPHQAAGRRFGLLFRYND

Amino Acids from 3' Exons

VMCILTDIHTTGCGSQQPRFLDYSLPLASQRSLFKNGIPKRPKNTSQNLQSSSPVTLTK,SCAFSPETSTQLGVAHSSPDFWITLCLLPARGAYSKMEYQKDQKTPPRTCSNQVPSQPPK,HVHSHLRHPHNWVWLTAAQIFGLLFASCQPEELIQKWNTKKTKKHLPEPVAIKFLASDLDQK