McDonnell Genome Institute

Washington University

CircRNA

chr12|101352054|101362060|+|UTP20|ENST00000261637.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9577

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

15

Peptide

LQVGDLDSCLDIMIEHENITTAATEIIGAICK

Amino Acids from 5' Exons

HENITTAATEIIGAICKHLSWSAYMYYLKHFIHVLQTGQINQKLGV,MKIPLLPQRLLEPFANISLGQRICITNISFMSYKRDRSIKNWVS,KYNHCCHRDYWSHLQTSLLVSVYVLLETFHSCLTNGTDQSKTGCQ

Amino Acids from 3' Exons

VHVLTFTVHMLLQGLTNKLQVGDLDSCLDIMIE,SMCLSPFTCCCKASPISCRSEIWTLVIL,PCADFHRSHAAARPHQAAGRRFGLLFRYND