McDonnell Genome Institute

Washington University

CircRNA

chr12|101342445|101344750|+|UTP20|ENST00000261637.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9718

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

4

Peptide

SQTEDTEVDILVTVQNLLK

Amino Acids from 5' Exons

DTEVDILVTVQNLLKHCVDPTSFLKPIAKLFSVIKNKLSRKLLCTVFE,IQRLIFWQYKTCSIVWTLQASSSLQNFSQLLRTNCQENCFVRFL,YRGYSGDSTKLVKALCGPYKLPQAYSKTFLSYEQIVKKIALYGF

Amino Acids from 3' Exons

LGDMSLSDNASMCLMSIIKKLAALNVTEKDYREIIHRSLLEKLRKGLKSQTE,EIVVIMPACAVSSKSLPMSQRKTIEKSSTVHSWRNEKVRARQ,RRYEFKCQHVPDEYHQKASCLECHRERLRNHPPFTPGEIEKRSEEPDR