McDonnell Genome Institute

Washington University

CircRNA

chr12|101333300|101343093|+|UTP20|ENST00000261637.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9093

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

21

Peptide

MQIVDVNYLIPVMHNCFYNLEIQLR

Amino Acids from 5' Exons

IQLRFINPLKNLRRLGIKMVTDIFLDWESYQFRTEEIDAVFHGAVWPQ,YSDLLIHKIDVLESKWLISFWTGNHISLEQKKLMLCFMVQFGP,TAEIYSIEKFKTSWNQNGNYLFGLGIISVNRRNCCVSWCSLAP

Amino Acids from 3' Exons

LNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLE,LTPSIKDILMISTSTFALRLSRPSPLTLKKCKLWMLTTFQLCIIVSII,RLRSKTSYQLRRSLDFPDHHLLHRNANCGCLPNSSYALFLSR