McDonnell Genome Institute

Washington University

CircRNA

chr12|101311718|101312276|+|UTP20|ENST00000261637.4

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9502

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

FINSHAHEMENK

Amino Acids from 5' Exons

FSCTRNGKAILESLLASRKSSYAC,SHAHEMENKQFWKVYYEHLEKAATHA,LMHTKWKISNFGKSTMSIKKQLRML

Amino Acids from 3' Exons

RRNYRMIQMRSPLEMKVGSRPRKEMLELFIMSSHKLTVRKDLTTPTSDSCSGELPNSQKESHGPGSFPRFSDLS,EGTTEYDREVRWRKLGADPGRRCWSSLSAVSIENLSGKTPHQLQIPALESSDQIPRKSRATVQGAFPAFLEIYQ,KELQNDMTDEKSVGDESWEQTQEGDVGALYHEQLALKTDCQERLDHTNFRFLLWRALTKFPERVEPRSRELSPLFLRFI