McDonnell Genome Institute

Washington University

CircRNA

chr12|100901645|100987670|+|ANO4|ENST00000392977.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9526

31

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

GSISLSLSIHGAEK

Amino Acids from 5' Exons

VVYLFMGLKSVCKSINGEVWQAAQRHVVACLWSGIPHSHQAEGQKWRQALLESLMEKPKSSTQ,FKFIYSWGKAFANPSTAKCGKPPSVTSSPACGQAFLTPTRQKVNKNGGKLFWNHWKNQSLPP,LSLSIHGAEKRLQIHQRRSVASRPASRRRLPVVRHSSLPPGRRSIKMEASSSGITNGKTKVFHP

Amino Acids from 3' Exons

DRTNKQVSEMVTEANEAGQGDTARPGGELLHCPFQPAKDPS,IDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIH,SINKAGFGDGYLRSQGWTRRHCQTWRRMTATLPLSASKGSI