McDonnell Genome Institute

Washington University

CircRNA

chr12|100291502|100317925|+|SCYL2|ENST00000360820.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9835

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

10

Peptide

ALEAPSIQIQEVAVFVFDK

Amino Acids from 5' Exons

EVAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEES,KWQFLSLIKNLTSIKNLKRIKSLILNEESNSLGFDTLDFLLSSILKNP,SGSFCLKTDQVSKIKGSNHFSKTRSPTVNSASTPSTSYCPASFRRIQ

Amino Acids from 3' Exons

ILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQ,FCFSYKKWICYPKPLLMRRTVFYPWFTEHKLLPFRS,FVNFPTKNGFATNQNPSDKEQCSTHGLQSTRSSFHSDP