McDonnell Genome Institute

Washington University

CircRNA

chr12|100057570|100089095|-|UHRF1BP1L|ENST00000279907.11

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9812

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

MEVIAICFWKK

Amino Acids from 5' Exons

WKAGTLPTQPGSSLCFLEYEKKLFTNVIGYHFTQHDIGRTVIRKWKPYVFGK,GKPKERCPPNLAPLCVSYKNMKRSSSQMSLDTISLDSMILEEQLLESDGSDSHMFLEK,ESLRNVAHPTWLLSVFLIRIKEALHKCHWIPFHLTAYWKNSYKVMEVIAICFWKK

Amino Acids from 3' Exons

SSTVVASAQQVKTTQTSNAPDVNDAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEK,ALQSHLPSKRQRKLQMLLMMMQLNYSMILMLRKPPIIFLIIYTYVMTFMLKKK,LYSSRICPASEDNANFKCSCKCNCETIQFCGNLPSFSDFSSRSTHMHSCRK