McDonnell Genome Institute

Washington University

CircRNA

chr11|9963772|10031170|-|SBF2|ENST00000256190.12

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9764

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

ILETEKGTK

Amino Acids from 5' Exons

FRWTRRQFSTVHKDKLSETVSHSYLKIKFWKLK,FDNGQGDDSFQQCTKTRSCQKLYLIHIKNFGNK,SIMDKVTTVFNSAQRLEVVRNCISFIFENKILETEK

Amino Acids from 3' Exons

GTKKEEIEGEAKVSGLIQPAEVFAPKSLVLVSRLYYPEIFR,EQRRKRLKVKQKCLVFSLQKCLLPKAWCWYPDYIIQKFL,NKEGRDRSKSVWFNSACRSVCSQKPGVGIQIILSRNF