McDonnell Genome Institute

Washington University

CircRNA

chr11|993753|994245|+|AP2A2|ENST00000332231.9

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9632

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

AAPVHLHQVR

Amino Acids from 5' Exons

PADPVPPAALQVPPVQRPHPRAAPVHLHQVREPLPGGEAHHPGRAAQRQPAQERRRGAAAACCGVPAAQHRGQHRHS,PLIQFHLLHSKFHLCSVPTRALLLSTYIKFVNLFPEVKPTIQDVLRSDSQLRNADVELQQRAVEYLRLSTVASTDIL,RSSSTCCTPSSTCAASPPARCSCPPTSSSTSSRRSPPSRTCCAATASSGTQTWSCSSVLWSTCGSAPWPAPTF

Amino Acids from 3' Exons

ATVLEEMPPFPERESSILAKLKKKKGPSTVTDLEDTKRDRSVDVNGGPEPAPASTSAV,RPCWRRCPHSRSGSPPSWQSSRRRRAPARQTWRTPSGTGVWTTGVLSLPQPVPAP,DRAGGDAPIPGAGVLHLGKAQEEEGPQHGDRPGGHQAGQECGRERGSACPSQYQRR