McDonnell Genome Institute

Washington University

CircRNA

chr11|992502|994245|+|AP2A2|ENST00000332231.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.914

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

18

Peptide

SVDVNGGPEPAPASTSAVVLK

Amino Acids from 5' Exons

VLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAAKTVFE,CRSPSWLRSTRWTTPGMWIPSTSELLVITVKRCGTESFRSSSTGTTCRATRPRLCS,AEGRHPGEVRGGLHLVCGYHLELDPNCWLRERGVVPSHSDRHQPGRRAGLRGQDCVR

Amino Acids from 3' Exons

ATVLEEMPPFPERESSILAKLKKKKGPSTVTDLEDTKRDRSVDVNGGPEPAPASTSAV,RPCWRRCPHSRSGSPPSWQSSRRRRAPARQTWRTPSGTGVWTTGVLSLPQPVPAP,DRAGGDAPIPGAGVLHLGKAQEEEGPQHGDRPGGHQAGQECGRERGSACPSQYQRR