McDonnell Genome Institute

Washington University

CircRNA

chr11|986784|993381|+|AP2A2|ENST00000332231.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9955

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

19

Peptide

VGGYILGEFGNLIAGDPRSSEPNLLVR

Amino Acids from 5' Exons

AEPARPCLQPVGPVSAAPRDQPALPGPGEHVHAGQLVLPGCQDAHRDGHQRPE,EPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEFSHEAVKTHIETVINALK,SRTCSSVPATSWASFCSTARPTCATWPWRACARWPALSSPMRLSRRTSRRSSTP

Amino Acids from 3' Exons

ALQAPACHENLVKVGGYILGEFGNLIAGDPRS,LFRLPRATRTWSKWAATSWGSLETLETRDP,SSGSRVPREPGQSGRLHPGGVWKLDSWRPEIQ