McDonnell Genome Institute

Washington University

CircRNA

chr11|95838093|95845159|-|MTMR2|ENST00000346299.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9886

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

ELILAGALR

Amino Acids from 5' Exons

FPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKE,FLPHLNSMSIFSLPFWTTYTAAYSEHSSVIVNNREEK,SYRIIQVFSHYHFGPPIQLLIRNIPLTTERKR

Amino Acids from 3' Exons

LILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQL,LFLQGLLGLLTRSQGRRLWCIAVMVGIAQLSSLPLPCSCWMDTIEPSEDLKSLWRKNGVLDIDFN,YSCRGSDCQGRVREDVCGSALQWLGSHSSAHFPCHAHVGWILSNHPRISPCGERMAKFWTSIST