McDonnell Genome Institute

Washington University

CircRNA

chr11|94577277|94607639|+|PIWIL4|ENST00000299001.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9957

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

11

Peptide

LGGELWAVEIPVPVEYL

Amino Acids from 5' Exons

VPVEYLNWLQTSLTIFPKTGSYTSTMHIFQIHLEGELLYFIVIVNFPTKQKHSTVPSFFCHKSKK,FQWNTCETGYKPLLRFSPRLAAIPVPCDIYSRFSIKAENCFTLSTFQQSKSIRRCHPFSVTKARRK,SSGIPVKLVTNLFNLDFPQDWQLYQYHVTYIPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEK

Amino Acids from 3' Exons

VMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMTCKLGGELWAVEIP,CAFCLLIRRPIMIPLKNIAQTAQSQANVCLLGPINRAVSPPRSLCRLASSEASCGLWKY,NVHSAFSEDLLFHKIFELRLPSPKPMCACSDLETGHDDEYRHQDRYADDLQARRRAVGCGNT