McDonnell Genome Institute

Washington University

CircRNA

chr11|93757315|93759858|+|C11orf54|ENST00000331239.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9195

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

DPVIEVK

Amino Acids from 5' Exons

VIEVKAKRRTGPLNFVTCMRETLEKHYGNKPIGMGGTFIIQKGKVKSHIM,LRKPKEELDHLTLLVERPWKNIMEISLEWEVLSFRREKSLTL,NGESQKKNWTTLCDLYERDPGKTLWKAYRNGRYFHNSEGKSEVSHY

Amino Acids from 3' Exons

PAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDP,LQNFLPAPTLMKKINGCIFMKKLLWFVYQFLSPET,CRIFFLPLELRSEMVAFLNESSFGLSTSFCLQRP