McDonnell Genome Institute

Washington University

CircRNA

chr11|850287|865825|+|TSPAN4|ENST00000464987.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

AVGCTPPAPGGR

Amino Acids from 5' Exons

NSAAAWRAPASRPSSTSCSPSTCSS,TEALRHGARLPPGRQVPHVRLQPALL,LKRCGMARACLQAVKYLMFAFNLLFW

Amino Acids from 3' Exons

FFLLLLLVFLLEATIAILFFAYTDKVRLPWPQAQLQGWGLHPHSQGALWARCGQSGPACALTGSQDSGCGFTRPGGAAPATLGGCAVALRLGHKGTATPPGGCAPGCPPPSDAASAVCSQRPIRAAHRGVLLCRAASSWSLTHIFSHLFILGSPGYGCTPSNTLLCFVNHTVRPWPWGASAVCCWVPRAPINRLFILGHVLTSWHCRALQAPSFPALAQESAPSPGCSGSSLNIGDRGQGAGWAQRSPLAFSSQSMAARVPIRGGTCVPVLCPPRTHGPPPAWGGSPEVGALGLRAAGRTWGRCVCSLVGEARGTQDQAQEGPSLGAGEGVWMREAGYSGRGPADPPRTPRLTGMPSKTRKACTCTARRATWASPTPGASSRPTGVGRWAGSAGAPSPPASARPELAPQFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKA,SSCCCCWCSCWRPPSPSSSSPTRTRYGCLGRRPNCRAGGSILTPREHCGPGVDRVALHVPSRAARTAGVDLPGLEGQRQRPWEAVLWLYSDWGTRALLPHPEGAPQVVPRPLTQRPEPSAPSAPSGPRTVGFSSVERPLLGHSLIYSAICLYWDEVLAIEVALRARTHYFVLITLSVLGPGELLPSAAGSPDVPPSTDFSFWGTSLPGTAGRSRLLHSLPWPRNQPLLQGALGPHILGTEARVLGGLSAHSPWLSAHRAWLHVSRYVEAPVSLSSVPPGPMVLPQPGEEAQRWGPWASGLLGGHGAGVSAAWWARRRGGHKTRRRRGPAGPARGSGGRRGTVGGALLTPPAPPDQVCPARPEERLAPVRHAGQRGPHQRLEHHPDRREAWAGGRGRRVPPPLLPQPDLSLPPSSAAVASPTTLTGSRCTTPRGYLTPAAWSSVRAVGCTPPAPGGR,LPAAAAGVPAGGHHRHPLLRLHGQGTAALAAGPTAGLGAPSSLPGSTVGPVWTEWPCMCPHGQPGQRVWIYQAWRGSASDPGRLCCGSIATGAQGHCYPTRRVRPRLSPALRSVLSRLLPAPHPGRAPWGSPLSGLFLVTHSYIQPFVYTGMKSWLLRLHSELEHTTLFCESHCPSLALGSFCRLLLGPLTCPHQQTFHFGARPDFLALQGAPGSFIPCPGPGISPFSRVLWVLTEYWGPRPGCWVGSALIAPGFQLTEHGCTCPDTWRHLCPCPLSPQDPWSSPSLGRKPRGGGPGPQGCWEDMGPVCLQLGGLGGAGDTRPGAGGAQLRGRRGGLDEGGGVQWEGPCPPPHPQIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDVRRGQVGGVGGCPLPSCLSPTACPPVPLLWRLQLHLVRGVQRHAGTLLLLGVQELWAARPRHLVEG