McDonnell Genome Institute

Washington University

CircRNA

chr11|83471625|83541858|-|DLG2|ENST00000280241.12

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9344

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

WGSSPAKG

Amino Acids from 5' Exons

TTPGRLSWGPRIGSMTTYLNSLINLAPVCL,KLHPAGDYPGAHEGSDQRLDIIPIWLLCA,NYTRPVIILGPMKDRINDDLISEFPDKFGSCVP

Amino Acids from 3' Exons

SHVRLRQEQGQWAAKSRTFIWRYSPRYQCLVVASQESHAGGRQGDGGHPQQKE,AMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEMGVIPSKR,PCSTTTRARTVGCQVKDLVLNMEIFSTLSMPLMMSGGKPGESCWRETVRRWGSSPAKG