McDonnell Genome Institute

Washington University

CircRNA

chr11|83164206|83167898|+|PCF11|ENST00000530660.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9256

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

QVGIVEHSLTEK

Amino Acids from 5' Exons

PEEPSTPGTVVSSPSISTPPIVPDIQKNLTQEQLIRQQLLAKQKQLLELQQKKLELELEQAKAQL,PRSLQHLVQWSVPLASPLLQLFLIYKRILHKNNGSSYWQSKNSCNFSRKSWSLSSKLRHS,RGAFNTWYSGQFPHLHSSNCSYTKESYTRTTNKAAVTGKAKTVVRTSAEKAGAARASGTV,PEEPSTPGTVVSSPSISTPPIVPDIQKNLTQEQLIRQQLLAKQKQLLELQQKKLELELEQAKAQL,PRSLQHLVQWSVPLASPLLQLFLIYKRILHKNNGSSYWQSKNSCNFSRKSWSLSSKLRHS,RGAFNTWYSGQFPHLHSSNCSYTKESYTRTTNKAAVTGKAKTVVRTSAEKAGAARASGTV

Amino Acids from 3' Exons

TSERLASGEITQDDFLVVVHQIRQLFQYQEGKHRCNVRDSPTEENKGGLKKKPLLSDAELTYYEHKAKLKRTQVQHSFPRLDLLDPDIFDYPLTDALLSGIECEPSKSKHASRNSGAQFDRKEQFSERARRLSPISGSRTYAENLSPHEGRRRHDEQVSAK,RVNVHLVKLHRMTSLLLCIKFDSYFSIKKVNIDAMYGIVLQKKIKVDKRNLSYLMLNPTMNIKQNKGHRFSIHFQDLISILIFLTTLLMPCCLENVSHPKVNMQVGIVEHSLTEKNNLVKEQDVFLLYLGVVLMLRIFHPMRAGEDMTSKSLLK,ETFSIWNYTGLPCCCASNSTAISVSRRTMQCTGSYRRKRWIKKETSLICINLLTSKTEKDTGSAFISKTSLRSYFLPFDCLVVWNRMAIQKTCKEWSTVQKRTIKSKTSFSYIWESYLCESFTPGPEKTRASLC,TSERLASGEITQDDFLVVVHQIRQLFQYQEGKHRCNVRDSPTEENKGGLKKKPLLSDAELTYYEHKAKLKRTQVQHSFPRLDLLDPDIFDYPLTDALLSGIECEPSKSKHASRNSGAQFDRKEQFSERARRLSPISGSRTYAENLSPHEGRRRHDEQVSAK,RVNVHLVKLHRMTSLLLCIKFDSYFSIKKVNIDAMYGIVLQKKIKVDKRNLSYLMLNPTMNIKQNKGHRFSIHFQDLISILIFLTTLLMPCCLENVSHPKVNMQVGIVEHSLTEKNNLVKEQDVFLLYLGVVLMLRIFHPMRAGEDMTSKSLLK,ETFSIWNYTGLPCCCASNSTAISVSRRTMQCTGSYRRKRWIKKETSLICINLLTSKTEKDTGSAFISKTSLRSYFLPFDCLVVWNRMAIQKTCKEWSTVQKRTIKSKTSFSYIWESYLCESFTPGPEKTRASLC