McDonnell Genome Institute

Washington University

CircRNA

chr11|78786897|78903523|-|TENM4|ENST00000278550.11

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9784

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

20

Peptide

AAPDAAAAALARPHPQPAPR

Amino Acids from 5' Exons

RSVLPTVVAMACAGAPAAARMAGWGQPATSGPATRAVPSMGPAATASASAALAGMANTAPS,DLCCRLWWPWRVRRGHLPLRGWLDGGSLRPAGLPPALCRAWDLPRRQVRVQPWLEWRTLHH,ICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRCAEHGTCRDGKCECSPGWNGEHCTI

Amino Acids from 3' Exons

IIRAACRTTRGSGRRRRRSRTPTPPTSTTRPPLTPTGATSRRGATPARPPRTTRSPESPLPAAPRSLPTPRRTGCSTATSPWRP,SSGRPAEPRAAPDAAAAALARPHPQPAPRGLHLPEPGQLHAEEQPQPGPHGPLALRRAPCRRRPGACPRPGELAAQQQHPPGDQ,HPGGLQNHARLRTPPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPPAGGAQEPAHAQENWLLNSNIPLET