McDonnell Genome Institute

Washington University

CircRNA

chr11|78738450|78787083|-|TENM4|ENST00000278550.11

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

LSITLSLDIQSAGK

Amino Acids from 5' Exons

ACLCYSWPSDDIRWNPPGWCEHQFCQPSLWIYNQQARWQ,HACVIRGQVMTSDGTPLVGVNISFVNNPLFGYTISRQDG,MLVLFVAKHQMEPPWLVTSVLSITLSLDIQSAGKMA

Amino Acids from 3' Exons

RSVLPTVVAMACAGAPAAARMAGWGQPATSGPATRAVPSMGPAATASASAALAGMANTAPS,DLCCRLWWPWRVRRGHLPLRGWLDGGSLRPAGLPPALCRAWDLPRRQVRVQPWLEWRTLHH,ICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRCAEHGTCRDGKCECSPGWNGEHCTI