McDonnell Genome Institute

Washington University

CircRNA

chr11|78722667|78726222|-|TENM4|ENST00000278550.11

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

IFPSGNVTNILELSFR

Amino Acids from 5' Exons

ASCTKGMGRTSLCLSSLLSLGASWAMGAGEASPAPAATALLTATSSWPQWPSPVALTGASMWVISTTLEGSSPLEMSPTSS,HPAQREWGEPVCVSAASCHWEHHGQWAPEKHLLPQLQRPCRQQAPGPSGPHLWLREPLCGFQLHKDLPLWKCHQHPRAE,ILHKGNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCGSDGSLYVGDFNYIRRIFPSGNVTNILEL

Amino Acids from 3' Exons

FPWVMNMNPAQISCGKKEQQCCRAMKLTRPSLEDGATNIMPSTFKV,FRGLIILPRSNPVGKKNNSAAGLNRVQAWRMEPRQTSCPQHSK,SVGYEYESCPDLILWEKRTTVLQGYEIDASKLGGWSLDKHHALNIQS