McDonnell Genome Institute

Washington University

CircRNA

chr11|78196235|78200808|+|USP35|ENST00000529308.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9948

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

EAGAGSAR

Amino Acids from 5' Exons

RGRHGQDLGGGGDVVIPGQREAGAGSARAGGGAAAAGAAVPGAAGAGRAPLRGRRGGAAAPRGLPAAARGRPPPPRRLRRVLQRASRAAPAAGWRRPPGPPRARLRAAGSAAAARGACGRRGVRAAAARGAAHRVRAPGPRGLRAGGTAAGSPPALCARRTPPPALLPAAGALPRPLPLPSRRRGGRRGVPRAGPAGERAPGAAVARTARRHPALPQRAVRSHLLR,AGAMDKILEAVVTSSYPVSVKQGLVRRVLEAARQPLEREQCLALLALGARLYVGGAEELPRRVGCQLLHVAGRHHPDVFAEFFSARRVLRLLQGGAGPPGPRALACVQLGLQLLPEGPAADEVFALLRREVLRTVCERPGPAACAQVARLLARHPRCVPDGPHRLLFCQQLVRCLGRFRCPAEGEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCA,RAPWTRSWRRWRRHTRSASRGWFGACWRRRGSRWSVSSAWRCWRWARASTWAARRSCRAAWAASCCTWPAATTPTSSPSSSARVACCACCRVAPAPRAPARSPACSWVCSCCPRGLRPTRCSRCCGARCCAPCASARAPRPARRWHGCWLATRAVCPTDPTACSSASSWCVASAASAAQPKARRAPWSSSRPSRAGSWRSCGAHSPPPSCPASKSCSQSSPAQ

Amino Acids from 3' Exons

LLPHIPPMVASLVKEDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIK,SSLTSPPWWPLWSRRTRTRGPAAWSSWRSWSTAWCSGSRASRICMSLSWRPS,PPSHPPHGGLSGQGGLELGDQLPGAAGGAGPLHGVPVPGLPGSVACHGGHQ