McDonnell Genome Institute

Washington University

CircRNA

chr11|77938650|77991299|-|INTS4|ENST00000433818.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9837

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

CMPQEEIATK

Amino Acids from 5' Exons

RKRTAHERAKELYSSGEFSSGRKWGDDAPKEEVDTGAVNLIESGACGAFVHGLEDEMY,GNVLHMSVPRNFTVRGSFPVAESGEMMLPRKKIPGLTLSQELVELLFMGWKMRCM,ETYCTACQGTLQFGGVFQWQKVGRCSQGRSRYRGCELDVRSLWSFCSWVGRDV

Amino Acids from 3' Exons

PQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYK,HRRKLLLRNSDQNQVNLQHSTICVKLPPQQMLCNTCSSLPGSLSRRKARESGFSWNIIT,TGGNCYETPTNKTKICSTPHRSVSYLPSRCFAILAPVCQEACRGGKRRGSSQDSLGTLLQ