McDonnell Genome Institute

Washington University

CircRNA

chr11|77672041|77676999|-|RSF1|ENST00000308488.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9955

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

LSSSESEGVGRGK

Amino Acids from 5' Exons

KVTSVMILVMILKLGEGGQGEIRKDKLTTKKTQKVTVPRRVCDVVKKGEYTSEDFPAQRVK,KLQFFCRNSAKAVKEKSEKTNLQRRLRKRFPEEFATWRNKASTQAKTFQLRE,SDFSDDFSDDFVETRRRRSRRNQKRQINYKEDSESDGSQKSLRRGKEIRRVHKRRLSSSESE

Amino Acids from 3' Exons

ELAEEKISPPSQVIVGKTSLLFWMKKEKKINDPRGQLLLEGRNAGDMIWTVIATWMKKRARMNSRSVM,SWPRKRYLHHHRSSWERHLYYFGRKKRKTTPEGSCCSKEETPAIKSGQQPGRRERGIQDQW,VGRGKDISTITGHRGKDISTILDEERKENKRPQRAAAARRKKRRRLNDLDSDSNLDEEESEDEFKISD