McDonnell Genome Institute

Washington University

CircRNA

chr11|75566315|75569171|+|SERPINH1|ENST00000358171.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9239

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

GGGLVAR

Amino Acids from 5' Exons

AHRGARKPLPGHALPPASQRLLPPGGGPGRRGEETCSRSSSWHCGEVEPQGGHACRAQRRPGLQLVPGHGQGPGSGEHPGVTRGGGLVARARVAGRQGDHGVAGQGSAERRAAARRGGARRPGRAAALTQQLHGAQRDLEAGQPTVRTQLSELRLRAQQQAALQLRALQDQLPRQAQRAAVHQRVGRADHRRQAARGHQGRGAHGRRPASQRHVLQ,PTVVHANHFLAMRSLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDGKLPEVTKDVERTDGALLVNAMFFK,PPWCTQTTSWPCAPSCFSAPSASWRRPWPPRRNLQPQQLLALRRSAPRRPRLPSAAPAWPSACTRPWPRTRQWRTSWCHPWWWPRRGSCRWAARRPRRRRPRQCAPSSCATRRCTPAWASCCAHSATPRRATPGSWAADCTDPAQASLMTSCAAASSTTTASTPRSTSATSAARCSPSTSGPRRPPTASCPRSPRTWSARTAPCSTPCSSS

Amino Acids from 3' Exons

ASTTTTTTRRKSCKSWRCPWPTSSPASSSSCPITWSLSSALKSCPKSSRSGWGRCRRRLLPSPCPRVWWRPMTC,PLQLLRRREGKAANRGDAPGPQALQPHHPHAPSRGASRAPKAANQRAAEDLDGEDAEEGCCHLLAQGCGGGDPPA,LYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQ