McDonnell Genome Institute

Washington University

CircRNA

chr11|74594060|74618804|+|POLD3|ENST00000263681.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9174

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

EVTNVTYK

Amino Acids from 5' Exons

VTYKWLSYTLGVHVNQAK,HTNGAIHGFMLTRPN,DIQMAELYTRGSCPGQT

Amino Acids from 3' Exons

ICYTMCSCRPSSCILFVFQKVAVTSSHVKDTSQQADHQWSWPTCIQAGFPAAQRNYGNVCLQSCCNPRNQQGNENRGRSNK,FSAIQCAAAVPRAPAESSSSSKKFEQSHLHMSSETQANNELTTNGHGPPASKQVSQQPKGIMGMFASKAAAKTQETNKETKTEAKEVTN,LVLYNVQLPSLELLLNPLRLPKSLSSHIFTCQVRHKPTMSPPMVMAHLHPSRFPSSPKELWECLPPKLLLKPKKPTRKRKQRLKKQ