McDonnell Genome Institute

Washington University

CircRNA

chr11|74342460|74368575|-|PGM2L1|ENST00000298198.4

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9095

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

SPYAVQK

Amino Acids from 5' Exons

IWLSYFKNFLFLVLTTYHQKYIKASFFSKRISKILWNICYIACTGRYHWIQPAEI,YGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYDSSQPNKKS,MVIIFQKLPISCVMNHLPSKVYLKGFVILILQKNIQNFVEHLLYCMYGTLPLDMTVASLIRN

Amino Acids from 3' Exons

PYAVQKLKAVAGVMITASHNRKEDNGYK,HMQFRSSKQLQVLLPLTTARKTMDT,ICSSEAQSSCRCDDYCLSQPQGRQWIQ