McDonnell Genome Institute

Washington University

CircRNA

chr11|73394476|73394734|+|RELT|ENST00000064780.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9426

52

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

SLAPAAPAVAR

Amino Acids from 5' Exons

AAASAPERATHLPAPPPSPHRAGPGLALWPLLLPLPEEVARGAAVPGCSRHYSCSQPSAPDQGSQGRGQGRASGRDHHLVCGQ,LPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQKKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVG,CRQRPRTCHTSARTATISTPCRAWPRSLAPAAPAVARRSGPRCCCPLRLPPLLLFPAFCLTRPGFPRPGPRQGVRARSPSCLWA

Amino Acids from 3' Exons

AAASAPERATHLPAPPPSPHRAGPGLALWPLLLPLPEEVARGAAVPGCSRHYSCSQPSAPDQGSQGRGQGRASGRDHHLVCGQ,LPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQKKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVG,CRQRPRTCHTSARTATISTPCRAWPRSLAPAAPAVARRSGPRCCCPLRLPPLLLFPAFCLTRPGFPRPGPRQGVRARSPSCLWA