McDonnell Genome Institute

Washington University

CircRNA

chr11|72726619|72727172|-|ARAP1|ENST00000359373.9

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9031

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

13

Peptide

LLVSSGQSPASQASAGR

Amino Acids from 5' Exons

LWTKPCQSGLRWQEPWQRLGMLRYRWPSGCGHCTWSSTRGSLSSMAWCGPLSAKASATPAWTWACYSLVTAAASWLACSVPIPHRPLHPAPPHGLCPSATSSAHHLCLPLHPSRCPPLQRMRGSPLPHPSRPGGAAFRPPASPPHPQLPQTLCCPRCLLSGIWQSAFHPCRPAPDPPACW,SGQSPASQASAGRNHGRGWGCCAIGGRVAAGIAPGAVHGALAAWPGVGHVPRPQRHPPDGHGHATPWSPPPHPGWPAPCPYLTGPCTPPHPTACAHEAPHLPLTTCACHSTRAAAHHYRGGAPRCPTHPAPEELPSAHLLHHPIHSCPRPCAAPAACAAFGRAERSTRAAPHRTPPPAGE,LDKALPVRPPLAGTMAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRILAGLLRAHTSPAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPRRSCLPPTCFTTPSTAAPDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLV

Amino Acids from 3' Exons

LWTKPCQSGLRWQEPWQRLGMLRYRWPSGCGHCTWSSTRGSLSSMAWCGPLSAKASATPAWTWACYSLVTAAASWLACSVPIPHRPLHPAPPHGLCPSATSSAHHLCLPLHPSRCPPLQRMRGSPLPHPSRPGGAAFRPPASPPHPQLPQTLCCPRCLLSGIWQSAFHPCRPAPDPPACW,SGQSPASQASAGRNHGRGWGCCAIGGRVAAGIAPGAVHGALAAWPGVGHVPRPQRHPPDGHGHATPWSPPPHPGWPAPCPYLTGPCTPPHPTACAHEAPHLPLTTCACHSTRAAAHHYRGGAPRCPTHPAPEELPSAHLLHHPIHSCPRPCAAPAACAAFGRAERSTRAAPHRTPPPAGE,LDKALPVRPPLAGTMAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRILAGLLRAHTSPAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPRRSCLPPTCFTTPSTAAPDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLV