McDonnell Genome Institute

Washington University

CircRNA

chr11|720061|724829|+|EPS8L2|ENST00000318562.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9297

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

5

Peptide

DEVLEHLATFIMDK

Amino Acids from 5' Exons

HLATFIMDKSEAITSVDDAIRKLVQLSSKEKIWTQEMLLQVNDQSLRLLDIESQ,TWPHSSWTRAKPSRLWTTPSGSWCSAPRRRSGPRRCCCRTTSRCGCWTSSH,PGHIHHGQERSHHVCGRRHPEAGAAELQGEDLDPGDAAAGERPVAAAAGHRVT

Amino Acids from 3' Exons

GLPANTSHGQVRQDPVLHSPKCQRAIGAQGGPR,GYQPTPAMAKYVKILYDFTARNANELSVLKDEVLE,ATSQHQPWPSTSRSCMTSQPEMPTSYRCSRMRS