McDonnell Genome Institute

Washington University

CircRNA

chr11|71109940|71147338|-|SHANK2|ENST00000601538.5

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

CMDHIQHR

Amino Acids from 5' Exons

TNLKKCMDHIQHRLVEKITKMLDRGLDPNFHDPETG,PIRNAWITFSIAWWRRSPRCWTEAWIPISTTRRPE,QSEEMHGSHSASLGGEDHQDAGPRPGSQFPRPGDR

Amino Acids from 3' Exons

TQAAMPRSPTSSEDEMAQSFSDYSVGSESDSSKEETIYDTIRATAEKPGGARTEESQGNTLVIRVVIHDLQQT,HRQPCRAAQHPARTRWPRASPTTPWGRSQTAPKKRPSMTRSGPLRRSRAVPGRRRARATRWSAWSSMTCSR,TGSHAAQPNIQRGRDGPELLRLLRGVGVRQLQRRDHLHDPGHCGEAGRCQDGGEPGQHAGDPRGHPPAAD